Podrobnosti o doméně

financialdigitalmarketingmidwest.com

financialdigitalmarketingmidwest.com-logo5th Annual Digital Marketing Financial Summit - Midwest 2023

This event is dedicated to highlighting best practices in marketing innovation and ROI optimization. Hone your marketing approach with unparalleled expertise and stay one step ahead of your competitors. Explore emerging strategies and trends for marketing in a post-pandemic world. Strike the perfect balance between high tech and high touch to create loyal and engaged brand advocates. Prioritize content marketing and drive loyalty with relevant messaging. Increase personalization, identify segments and grow conversions. Benchmark best practices with 40+financial marketing leaders from North America’s most successful brands.

TLDcom
Datum vytvoření domény2019-02-14
Datum vypršení platnosti domény2024-02-14
Datum aktualizace domény2023-02-15
E-mail pro kontakt s administrátorem zneužití[email protected]
Telefon pro kontakt s administrátorem zneužití+1.4806242505
Telefon
1-866-298-9343 ,200
Alternativa
  • https://financialdigitalmarketingmidwest.com/feed/
  • https://financialdigitalmarketingmidwest.com/comments/feed/
  • https://financialdigitalmarketingmidwest.com/wp-json/wp/v2/pages/242
DNSSociální médiaSDÍLENÝ HOSTINGNS SkupinaWHOISRDAP

DNS

Zobrazit záznamy v systému domén, včetně, ale neomezeně, záznamů A, CNAME, MX a TXT.

A

Záznam A (Adresní záznam) je typ záznamu DNS (Domain Name System), který mapuje název domény na IPv4 (Internet Protocol verze 4) adresu.

NS

Záznam NS (Name Server) je typ záznamu DNS (Domain Name System), který určuje, které jmenné servery jsou autoritativní pro konkrétní doménu.
NS ZáznamIP
noah.ns.cloudflare.com
nelly.ns.cloudflare.com

MX

Záznam MX (Mail Exchange) je typ záznamu DNS (Domain Name System), který určuje poštovní server zodpovědný za přijímání e-mailových zpráv pro doménu.
ExchangePrioritaIP
_dc-mx.35b3aca23411.financialdigitalmarketingmidwest.com0

TXT

Záznam TXT (Textový záznam) je typ záznamu DNS (Domain Name System), který umožňuje přidat libovolné textové informace k doméně.
  • google-site-verification=8FhrOLTD2mKm661PY6b0lfM1yDXKz8z3eSODS4634kg
  • v=spf1 a mx include:websitewelcome.com ~all

Sociální média

SDÍLENÝ HOSTING

CoHosted se odkazuje na situaci, kdy více doménových jmen (webových stránek) používá stejnou IP adresu pro své odpovídající webové servery. Mohou patřit různým osobám nebo organizacím a mohou sloužit zcela odlišným účelům. Domény hostované na stejné IP adrese jako financialdigitalmarketingmidwest.com jsou: financialdigitalmarketingmidwest.com.

NS Skupina

Skupina Nameserverů se skládá z dvou nebo více nameserverů, často poskytovaných webovou hostingovou společností nebo registrátorem doménových jmen. Mít více nameserverů přidává redundanci a zlepšuje spolehlivost rozlišování DNS. Zde jsou domény používající následující nameserverů stejně jako financialdigitalmarketingmidwest.com: nelly.ns.cloudflare.com, noah.ns.cloudflare.com.

DOMÉNA
Celosvětové pořadí
KategorieNadpisAMX
diabetesselfmanagement.com
213,773
Diabetes Self-Management - Diabetes Blogs, Articles and Recipes
  • diabetesselfmanagement-com.mail.protection.outlook.com
outdoorphotographer.com
303,614
Outdoor Photographer Magazine - Outdoor Photographer
  • outdoorphotographer-com.mail.protection.outlook.com
birdwatchingdaily.com
379,758
BirdWatching - Your source for becoming a better birder
  • birdwatchingdaily-com.mail.protection.outlook.com
jazztimes.com
387,461
JazzTimes - Your source for all things Jazz
  • jazztimes-com.mail.protection.outlook.com
writermag.com
508,344
Novinky A Média
The Writer - Advice and inspiration for today's writer
  • writermag-com.mail.protection.outlook.com
glutenfreeliving.com
675,031
Jídlo A Nápoje
Gluten-Free Living
  • glutenfreeliving-com.mail.protection.outlook.com
appartqc.ca
755,253
AppartQC, l'incontournable plateforme de locations
  • _dc-mx.0e2d202abca6.appartqc.ca
ziogiorgio.it
944,354
-
  • aspmx.l.google.com
  • alt1.aspmx.l.google.com
  • alt2.aspmx.l.google.com
digitalphotopro.com
1,238,065
Digital Photo Pro
  • digitalphotopro-com.mail.protection.outlook.com
madavor.com
7,638,698
Home - Madavor Media
  • madavor-com.mail.protection.outlook.com
djuragankamar.com
9,950,851
-
Djuragan Kamar - Cari dan Booking Kost Diseluruh Indonesia
  • aspmx.l.google.com
  • alt3.aspmx.l.google.com
  • alt4.aspmx.l.google.com
dpmag.com
-
-
-
  • dpmag-com.mail.protection.outlook.com
golftipsmag.com
-
-
Home - Golf Tips Magazine
  • golftipsmag-com.mail.protection.outlook.com
mflix.cool
-
-
-
-
kubernetes.network
-
-
-
--
nrg30.com
-
-
-
  • aspmx2.googlemail.com
  • aspmx4.googlemail.com
  • aspmx.l.google.com
tor66.xyz
-
-
-
-
strategyinstitute.com
-
-
Home | Strategy Institute
  • strategyinstitute-com.mail.protection.outlook.com
ziobazar.it
-
-
-
  • mail.ziobazar.it
lightsoundjournal.com
-
-
-
  • aspmx.l.google.com
  • aspmx2.googlemail.com
  • aspmx3.googlemail.com
kwik.delivery
-
-
Kwik - Your Parcels delivered better, cheaper, Kwiker - Lagos, Nigeria
  • kwik-delivery.mail.protection.outlook.com
integrationmag.it
-
-
-
  • aspmx2.googlemail.com
  • aspmx3.googlemail.com
  • aspmx.l.google.com
djuraganvoucher.com
-
-
Djuragan Voucher
-
lightsoundjournal.de
-
-
-
  • aspmx2.googlemail.com
  • aspmx3.googlemail.com
  • alt1.aspmx.l.google.com

WHOIS

WHOIS je protokol pro dotazování a odpovědi používaný k získání informací o doménových jménech a IP adresách. Často se používá k získání registračních údajů a informací o vlastnictví pro konkrétní doménové jméno nebo IP adresu na internetu. Prozkoumejte nejdůležitější informace, včetně registračních údajů a informací o administrativním kontaktu pro financialdigitalmarketingmidwest.com. To zahrnuje jméno vlastníka, organizaci, e-mailovou adresu pro zneužití, telefonní číslo pro zneužití a data vytvoření a vypršení platnosti.

Souhrn

Datum aktualizace domény2023-02-15
Datum vytvoření domény2019-02-14
Datum vypršení platnosti domény2024-02-14
Název doményfinancialdigitalmarketingmidwest.com
Registrar WHOIS serverwhois.godaddy.com
Organizace registrovanéhoDomains By Proxy, LLC
Ulice registrovanéhoDomainsByProxy.com 2155 E Warner Rd
Město registrovanéhoTempe
Stát/provincie registrovanéhoArizona
PSČ registrovaného85284
Země registrovanéhoUS
Telefon registrovaného+1.4806242599
Fax registrovaného+1.4806242598
E-mail registrovanéhoSelect Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=financialdigitalmarketingmidwest.com
E-mail pro kontakt s administrátorem zneužití[email protected]
Telefon pro kontakt s administrátorem zneužití+1.4806242505

Surová data

whois.verisign-grs.com

Domain Name: FINANCIALDIGITALMARKETINGMIDWEST.COM Registry Domain ID: 2360707224_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2023-02-15T15:10:43Z Creation Date: 2019-02-14T17:41:47Z Registry Expiry Date: 2024-02-14T17:41:47Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NELLY.NS.CLOUDFLARE.COM Name Server: NOAH.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2023-07-02T01:19:07Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.

whois.godaddy.com

Domain Name: financialdigitalmarketingmidwest.com Registry Domain ID: 2360707224_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: https://www.godaddy.com Updated Date: 2023-02-15T10:10:41Z Creation Date: 2019-02-14T12:41:47Z Registrar Registration Expiration Date: 2024-02-14T12:41:47Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 2155 E Warner Rd Registrant City: Tempe Registrant State/Province: Arizona Registrant Postal Code: 85284 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=financialdigitalmarketingmidwest.com Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 2155 E Warner Rd Admin City: Tempe Admin State/Province: Arizona Admin Postal Code: 85284 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=financialdigitalmarketingmidwest.com Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 2155 E Warner Rd Tech City: Tempe Tech State/Province: Arizona Tech Postal Code: 85284 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=financialdigitalmarketingmidwest.com Name Server: NELLY.NS.CLOUDFLARE.COM Name Server: NOAH.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-07-02T01:19:14Z <<< For more information on Whois status codes, please visit https://icann.org/epp TERMS OF USE: The data contained in this registrar's Whois database, while believed by the registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of this registrar. By submitting an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise support the dissemination or collection of this data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone, postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Failure to comply with these terms may result in termination of access to the Whois database. These terms may be subject to modification at any time without notice.

RDAP

RDAP znamená Protokol pro přístup k registraci dat. Jedná se o protokol používaný pro přístup a získávání registrace dat pro internetové zdroje, jako jsou doménová jména, IP adresy a autonomní systémová čísla. RDAP má několik výhod oproti protokolu WHOIS, včetně podpory internacionalizace, zabezpečeného přístupu k datům a možnosti poskytovat diferencovaný přístup k registraci dat. Zde jsou surová data RDAP pro financialdigitalmarketingmidwest.com.

Souhrn

Datum registrace2019-02-14
Datum vypršení platnosti2024-02-14
Datum poslední změny2023-02-15
Zneužití Tel.480-624-2505
Zneužití E-mail[email protected]

Surová data

1{
2        "objectClassName": "domain",
3        "handle": "2360707224_DOMAIN_COM-VRSN",
4        "ldhName": "FINANCIALDIGITALMARKETINGMIDWEST.COM",
5        "links": [
6                {
7                        "value": "https://rdap.verisign.com/com/v1/domain/FINANCIALDIGITALMARKETINGMIDWEST.COM",
8                        "rel": "self",
9                        "href": "https://rdap.verisign.com/com/v1/domain/FINANCIALDIGITALMARKETINGMIDWEST.COM",
10                        "type": "application/rdap+json"
11                },
12                {
13                        "value": "https://rdap.godaddy.com/v1/domain/FINANCIALDIGITALMARKETINGMIDWEST.COM",
14                        "rel": "related",
15                        "href": "https://rdap.godaddy.com/v1/domain/FINANCIALDIGITALMARKETINGMIDWEST.COM",
16                        "type": "application/rdap+json"
17                }
18        ],
19        "status": [
20                "client delete prohibited",
21                "client renew prohibited",
22                "client transfer prohibited",
23                "client update prohibited"
24        ],
25        "entities": [
26                {
27                        "objectClassName": "entity",
28                        "handle": "146",
29                        "roles": [
30                                "registrar"
31                        ],
32                        "publicIds": [
33                                {
34                                        "type": "IANA Registrar ID",
35                                        "identifier": "146"
36                                }
37                        ],
38                        "vcardArray": [
39                                "vcard",
40                                [
41                                        [
42                                                "version",
43                                                {},
44                                                "text",
45                                                "4.0"
46                                        ],
47                                        [
48                                                "fn",
49                                                {},
50                                                "text",
51                                                "GoDaddy.com, LLC"
52                                        ]
53                                ]
54                        ],
55                        "entities": [
56                                {
57                                        "objectClassName": "entity",
58                                        "roles": [
59                                                "abuse"
60                                        ],
61                                        "vcardArray": [
62                                                "vcard",
63                                                [
64                                                        [
65                                                                "version",
66                                                                {},
67                                                                "text",
68                                                                "4.0"
69                                                        ],
70                                                        [
71                                                                "fn",
72                                                                {},
73                                                                "text",
74                                                                ""
75                                                        ],
76                                                        [
77                                                                "tel",
78                                                                {
79                                                                        "type": "voice"
80                                                                },
81                                                                "uri",
82                                                                "tel:480-624-2505"
83                                                        ],
84                                                        [
85                                                                "email",
86                                                                {},
87                                                                "text",
88                                                                "[email protected]"
89                                                        ]
90                                                ]
91                                        ]
92                                }
93                        ]
94                }
95        ],
96        "events": [
97                {
98                        "eventAction": "registration",
99                        "eventDate": "2019-02-14T17:41:47Z"
100                },
101                {
102                        "eventAction": "expiration",
103                        "eventDate": "2024-02-14T17:41:47Z"
104                },
105                {
106                        "eventAction": "last changed",
107                        "eventDate": "2023-02-15T15:10:43Z"
108                },
109                {
110                        "eventAction": "last update of RDAP database",
111                        "eventDate": "2023-06-30T04:35:36Z"
112                }
113        ],
114        "secureDNS": {
115                "delegationSigned": false
116        },
117        "nameservers": [
118                {
119                        "objectClassName": "nameserver",
120                        "ldhName": "NELLY.NS.CLOUDFLARE.COM"
121                },
122                {
123                        "objectClassName": "nameserver",
124                        "ldhName": "NOAH.NS.CLOUDFLARE.COM"
125                }
126        ],
127        "rdapConformance": [
128                "rdap_level_0",
129                "icann_rdap_technical_implementation_guide_0",
130                "icann_rdap_response_profile_0"
131        ],
132        "notices": [
133                {
134                        "title": "Terms of Use",
135                        "description": [
136                                "Service subject to Terms of Use."
137                        ],
138                        "links": [
139                                {
140                                        "href": "https://www.verisign.com/domain-names/registration-data-access-protocol/terms-service/index.xhtml",
141                                        "type": "text/html"
142                                }
143                        ]
144                },
145                {
146                        "title": "Status Codes",
147                        "description": [
148                                "For more information on domain status codes, please visit https://icann.org/epp"
149                        ],
150                        "links": [
151                                {
152                                        "href": "https://icann.org/epp",
153                                        "type": "text/html"
154                                }
155                        ]
156                },
157                {
158                        "title": "RDDS Inaccuracy Complaint Form",
159                        "description": [
160                                "URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf"
161                        ],
162                        "links": [
163                                {
164                                        "href": "https://icann.org/wicf",
165                                        "type": "text/html"
166                                }
167                        ]
168                }
169        ]
170}

Bezplatné Nástroje

Nástroj pro Vyhledání IP Adresy

Zadejte IP adresu pro získání podrobných informací o ní, včetně geografického umístění, poskytovatele, ASN a informací z Whois. Sledujte a lokalizujte IP adresy.

Vyhledávač Alternativních Webových Stránek

Prozkoumejte webové stránky a poskytněte výběr alternativních možností.

Jaké je Moje IP Adresa

Veškeré informace o vaší IP adrese. Umístění, časové pásmo, typ adresy (IPv4 nebo IPv6) a další. Zobrazte svou skutečnou veřejnou IP adresu.

FAQ

Na jakých IP adresách je financialdigitalmarketingmidwest.com hostován?

Na 2 IP adrese/ích je hostován financialdigitalmarketingmidwest.com. 104.21.34.165, 172.67.163.20

Kdy byla doména financialdigitalmarketingmidwest.com zaregistrována?

Doména financialdigitalmarketingmidwest.com byla zaregistrována 2019-02-14.

Kdy vyprší platnost domény financialdigitalmarketingmidwest.com?

Platnost domény financialdigitalmarketingmidwest.com vyprší 2024-02-14.